PDB entry 2f64

View 2f64 on RCSB PDB site
Description: Crystal structure of Nucleoside 2-deoxyribosyltransferase from Trypanosoma brucei at 1.6 A resolution with 1-METHYLQUINOLIN-2(1H)-ONE bound
Class: transferase
Keywords: SGPP, Structural GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE NDRT, Nucleoside 2-deoxyribosyltransferase, Trypanosoma brucei, Structural Genomics of Pathogenic Protozoa Consortium, transferase
Deposited on 2005-11-28, released 2005-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.166
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoside 2-deoxyribosyltransferase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb05.30H13.400
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57VC7 (8-End)
      • expression tag (2-7)
      • modified residue (8)
      • modified residue (23)
      • modified residue (41)
      • see remark 999 (52)
      • modified residue (63)
      • see remark 999 (92)
      • modified residue (99)
      • modified residue (110)
      • see remark 999 (117)
      • modified residue (135)
    Domains in SCOPe 2.07: d2f64a2, d2f64a3
  • Chain 'B':
    Compound: nucleoside 2-deoxyribosyltransferase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb05.30H13.400
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57VC7 (8-End)
      • expression tag (2-7)
      • modified residue (8)
      • modified residue (23)
      • modified residue (41)
      • see remark 999 (52)
      • modified residue (63)
      • see remark 999 (92)
      • modified residue (99)
      • modified residue (110)
      • see remark 999 (117)
      • modified residue (135)
    Domains in SCOPe 2.07: d2f64b2, d2f64b3
  • Heterogens: SO4, 12Q, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f64A (A:)
    mahhhhhhmrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqk
    niqmikdcdaviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvd
    kdnlrvegfglpfnlmlydgvevfdsfesafkyflanfpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f64A (A:)
    hhhhhhmrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqkni
    qmikdcdaviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvdkd
    nlrvegfglpfnlmlydgvevfdsfesafkyflanfps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f64B (B:)
    mahhhhhhmrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqk
    niqmikdcdaviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvd
    kdnlrvegfglpfnlmlydgvevfdsfesafkyflanfpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f64B (B:)
    hhhhhhmrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqkni
    qmikdcdaviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvdkd
    nlrvegfglpfnlmlydgvevfdsfesafkyflanfps