PDB entry 2f63

View 2f63 on RCSB PDB site
Description: Solution structure of HPPK in complex with inhibitor analogs AMPCPP and HP-1
Class: transferase
Keywords: alpha-beta-alpha fold, transferase
Deposited on 2005-11-28, released 2006-01-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  Species: Escherichia coli [TaxId:562]
  Gene: folK
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26281 (0-157)
  Domains in SCOPe 2.08: d2f63a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2f63A (A:)
  tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
  etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
  rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw