PDB entry 2f5q

View 2f5q on RCSB PDB site
Description: Catalytically inactive (E3Q) MutM crosslinked to oxoG:C containing DNA CC2
Class: hydrolase/DNA
Keywords: disulfide crosslink, DNA glycosylase, DNA repair, damage search, control complex, hydrolase/DNA COMPLEX
Deposited on 2005-11-26, released 2006-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.213
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formamidopyrimidine-DNA glycosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84131 (Start-273)
      • engineered (2)
      • engineered (165)
    Domains in SCOPe 2.07: d2f5qa1, d2f5qa2, d2f5qa3
  • Chain 'B':
    Compound: 5'-d(*ap*gp*g*tp*ap*gp*ap*cp*cp*tp*gp*gp*ap*cp*gp*c)-3'
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: 5'-d(*tp*gp*cp*g*tp*cp*cp*ap*(8og)p*gp*tp*cp*tp*ap*cp*c)-3'
    Species: synthetic, synthetic
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f5qA (A:)
    mpqlpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgk
    flkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvy
    akeeadrrpplaelgpeplspafspavlaeravktkrsvkallldctvvagfgniyvdes
    lfragilpgrpaaslsskeierlheemvatigeavmkggstvrtyvntqgeagtfqhhly
    vygrqgnpckrcgtpiektvvagrgthycprcqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f5qA (A:)
    pqlpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
    lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
    keeadrrpplaelgpeplspafspavlaeravktkrsvkallldctvvagfgniyvdesl
    fragilpgrpaaslsskeierlheemvatigeavmkggstvrtyvntqgeagtfqhhlyv
    ygrqgnpckrcgtpiektvvagrgthycprcqr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.