PDB entry 2f5m

View 2f5m on RCSB PDB site
Description: Cross-linked barnase soaked in bromo-ethanol
Class: hydrolase
Keywords: denaturation, lysozyme, barnase, cross-linked crystals, glutaraldehyde, urea, thiourea, bromoethanol
Deposited on 2005-11-26, released 2006-04-25
The last revision prior to the SCOP 1.75 freeze date was dated 2006-06-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.178
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2f5ma1
  • Chain 'B':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2f5mb1
  • Chain 'C':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2f5mc1
  • Heterogens: BRJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2f5mA (A:)
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2f5mB (B:)
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2f5mC (C:)
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir