PDB entry 2f5m

View 2f5m on RCSB PDB site
Description: Cross-linked barnase soaked in bromo-ethanol
Class: hydrolase
Keywords: DENATURATION, LYSOZYME, BARNASE, CROSS-LINKED CRYSTALS, GLUTARALDEHYDE, UREA, THIOUREA, BROMOETHANOL, hydrolase
Deposited on 2005-11-26, released 2006-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.178
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f5ma_
  • Chain 'B':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f5mb_
  • Chain 'C':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f5mc_
  • Heterogens: BRJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f5mA (A:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f5mB (B:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f5mC (C:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir