PDB entry 2f5k

View 2f5k on RCSB PDB site
Description: Crystal structure of the chromo domain of human MRG15
Class: gene regulation
Keywords: beta barrel, GENE REGULATION
Deposited on 2005-11-26, released 2006-11-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.227
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MORF-related gene 15 isoform 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_006782
    Domains in SCOPe 2.01: d2f5ka1
  • Chain 'B':
    Compound: MORF-related gene 15 isoform 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_006782 (Start-101)
    Domains in SCOPe 2.01: d2f5kb_
  • Chain 'C':
    Compound: MORF-related gene 15 isoform 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_006782
    Domains in SCOPe 2.01: d2f5kc_
  • Chain 'D':
    Compound: MORF-related gene 15 isoform 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_006782
    Domains in SCOPe 2.01: d2f5kd_
  • Chain 'E':
    Compound: MORF-related gene 15 isoform 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_006782
    Domains in SCOPe 2.01: d2f5ke_
  • Chain 'F':
    Compound: MORF-related gene 15 isoform 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_006782
    Domains in SCOPe 2.01: d2f5kf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f5kA (A:)
    mhhhhhhamgilmapkqdpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysg
    wnknwdewvpesrvlkyvdtnlqkqrelqkanqeqyaegkmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f5kA (A:)
    dpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlky
    vdtnlqkqrelqkanqeqyaegk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f5kB (B:)
    mhhhhhhamgilmapkqdpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysg
    wnknwdewvpesrvlkyvdtnlqkqrelqkanqeqyaegkmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f5kB (B:)
    dpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlky
    vdtnlqkqrelqkanqeqyaegkmr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f5kC (C:)
    mhhhhhhamgilmapkqdpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysg
    wnknwdewvpesrvlkyvdtnlqkqrelqkanqeqyaegkmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f5kC (C:)
    pkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlkyv
    dtnlqkqrelqkanqeqyae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2f5kD (D:)
    mhhhhhhamgilmapkqdpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysg
    wnknwdewvpesrvlkyvdtnlqkqrelqkanqeqyaegkmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f5kD (D:)
    dpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlky
    vdtnlqkqrelqkanqeqy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2f5kE (E:)
    mhhhhhhamgilmapkqdpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysg
    wnknwdewvpesrvlkyvdtnlqkqrelqkanqeqyaegkmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f5kE (E:)
    dpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlky
    vdtnlqkqrelqkanqeq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2f5kF (F:)
    mhhhhhhamgilmapkqdpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysg
    wnknwdewvpesrvlkyvdtnlqkqrelqkanqeqyaegkmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f5kF (F:)
    pkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlkyvdt
    nlqkqrelqkanqeqyae