PDB entry 2f5i

View 2f5i on RCSB PDB site
Description: X-ray structure of spermidine/spermine N1-acetyltransferase (SAT) from Homo sapiens
Class: Transferase
Keywords: beta-alpha-barrels, Transferase
Deposited on 2005-11-25, released 2005-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-03-25, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diamine acetyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f5ia1
  • Chain 'B':
    Compound: Diamine acetyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f5ib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f5iA (A:)
    makfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevp
    kehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrc
    rcssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmateelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f5iA (A:)
    kfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpke
    hwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrc
    ssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f5iB (B:)
    makfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevp
    kehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrc
    rcssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmateelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f5iB (B:)
    kfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpke
    hwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrc
    ssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmate