PDB entry 2f58

View 2f58 on RCSB PDB site
Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120) (mn isolate)
Deposited on 1998-10-23, released 1999-02-09
The last revision prior to the SCOP 1.69 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.185
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f58H (H:)
    dvqlqqsgpdlvkpsqslsltctvtgysitsgyswhwirqfpgnklewmgyihysagtny
    npslksrisitrdtsknqfflqlnsvttedtatyycareeampygnqayyyamdcwgqgt
    tvtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfp
    avlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f58L (L:)
    divltqspaslavslgqratisckasqgvdfdgasfmnwyqqkpgqppkllifaastles
    giparfsgrgsgtdftlnihpveeedaatyycqqshedpltfgagtklelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnra