PDB entry 2f58

View 2f58 on RCSB PDB site
Description: igg1 fab fragment (58.2) complex with 12-residue cyclic peptide (including residues 315-324 of hiv-1 gp120) (mn isolate)
Class: immune system
Keywords: immunoglobulin, fab, hiv-1, gp120, v3, immune system
Deposited on 1998-10-23, released 1999-02-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: protein (igg1 fab 58.2 antibody (heavy chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2F58 (0-227)
    Domains in SCOPe 2.08: d2f58h1, d2f58h2
  • Chain 'L':
    Compound: protein (igg1 fab 58.2 antibody (light chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2F58 (0-215)
    Domains in SCOPe 2.08: d2f58l1, d2f58l2
  • Chain 'P':
    Compound: protein (hiv-1 gp120)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2F58 (0-10)
  • Heterogens: ARN, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f58H (H:)
    dvqlqqsgpdlvkpsqslsltctvtgysitsgyswhwirqfpgnklewmgyihysagtny
    npslksrisitrdtsknqfflqlnsvttedtatyycareeampygnqayyyamdcwgqgt
    tvtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfp
    avlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f58L (L:)
    divltqspaslavslgqratisckasqgvdfdgasfmnwyqqkpgqppkllifaastles
    giparfsgrgsgtdftlnihpveeedaatyycqqshedpltfgagtklelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnra
    

  • Chain 'P':
    No sequence available.