PDB entry 2f56

View 2f56 on RCSB PDB site
Description: Barnase cross-linked with glutaraldehyde soaked in 6M urea
Class: hydrolase
Keywords: denaturation, lysozyme, barnase, cross-linked crystals, glutaraldehyde, urea, thiourea, bromoethanol
Deposited on 2005-11-25, released 2006-04-25
The last revision prior to the SCOP 1.75 freeze date was dated 2006-06-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.162
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2f56a1
  • Chain 'B':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2f56b1
  • Chain 'C':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2f56c1
  • Heterogens: ZN, URE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f56A (A:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f56B (B:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f56C (C:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir