PDB entry 2f52

View 2f52 on RCSB PDB site
Description: Solution structure of cold shock protein CspB from Bacillus subtilis in complex with heptathymidine
Class: DNA binding protein/transcription
Keywords: beta barrel, OB-fold
Deposited on 2005-11-25, released 2006-09-19
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-24, with a file datestamp of 2007-06-04.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cold shock protein cspB
    Species: Bacillus subtilis
    Gene: cspB, cspA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f52a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2f52A (A:)
mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
anvtkea