PDB entry 2f4z

View 2f4z on RCSB PDB site
Description: Toxoplasma gondii ubiquitin conjugating enzyme TgTwinScan_2721- E2 domain
Class: structural genomics, unknown function
Keywords: ubiquitin conjugating TgTwinScan_2721, Structural Genomics, Structural Genomics Consortium, SGC, UNKNOWN FUNCTION
Deposited on 2005-11-24, released 2005-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.2
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TgTwinScan_2721 - E2 domain
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • PDB 2F4Z
    Domains in SCOPe 2.07: d2f4za1
  • Chain 'B':
    Compound: TgTwinScan_2721 - E2 domain
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • PDB 2F4Z
    Domains in SCOPe 2.07: d2f4zb_
  • Heterogens: UNX, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f4zA (A:)
    mgsshhhhhhssgrenlyfqgmataqprgtpreqarllkeladiqqlqrahdsepaaths
    tshgvsaqivggdihrwrgfiagplgtpyegghftldivippdypynppkmkfvtkiwhp
    nissqtgaicldilkhewspaltirtallsiqamladpvptdpqdaevakmmienhplfv
    qtaklwtetfake
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f4zA (A:)
    reqarllkeladiqqlgvsaqivggdihrwrgfiagplgtpyegghftldivippdypyn
    ppkmkfvtkiwhpnissqtgaicldilkhewspaltirtallsiqamladpvptdpqdae
    vakmmienhplfvqtaklwtetfak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f4zB (B:)
    mgsshhhhhhssgrenlyfqgmataqprgtpreqarllkeladiqqlqrahdsepaaths
    tshgvsaqivggdihrwrgfiagplgtpyegghftldivippdypynppkmkfvtkiwhp
    nissqtgaicldilkhewspaltirtallsiqamladpvptdpqdaevakmmienhplfv
    qtaklwtetfake
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f4zB (B:)
    eqarllkeladiqqgvsaqivggdihrwrgfiagplgtpyegghftldivippdypynpp
    kmkfvtkiwhpnissqtgaicldilkhewspaltirtallsiqamladpvptdpqdaeva
    kmmienhplfvqtaklwtetfak