PDB entry 2f4y

View 2f4y on RCSB PDB site
Description: Barnase cross-linked with glutaraldehyde
Class: hydrolase
Keywords: DENATURATION, LYSOZYME, BARNASE, CROSS-LINKED CRYSTALS, GLUTARALDEHYDE, UREA, THIOUREA, BROMOETHANOL, hydrolase
Deposited on 2005-11-24, released 2006-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f4ya_
  • Chain 'B':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f4yb_
  • Chain 'C':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f4yc_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f4yA (A:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f4yB (B:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f4yC (C:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir