PDB entry 2f4w

View 2f4w on RCSB PDB site
Description: Human ubiquitin-conjugating enzyme E2 J2
Class: ligase
Keywords: Endoplasmic reticulum, Ligase, Ubl conjugation pathway, Structural Genomics Consortium (SGC)
Deposited on 2005-11-24, released 2005-12-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme E2, J2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2J2
    Database cross-references and differences (RAF-indexed):
    • GB CAI23258
    Domains in SCOPe 2.08: d2f4wa1
  • Chain 'B':
    Compound: ubiquitin-conjugating enzyme E2, J2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2J2
    Database cross-references and differences (RAF-indexed):
    • GB CAI23258
    Domains in SCOPe 2.08: d2f4wb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f4wA (A:)
    gsmsstsskrapttatqrlkqdylrikkdpvpyicaeplpsnilewhyvvrgpemtpyeg
    gyyhgklifprefpfkppsiymitpngrfkcntrlclsitdfhpdtwnpawsvstiltgl
    lsfmvekgptlgsietsdftkrqlavqslafnlkdkvfcelfpevveeikqkqkaqdels
    srpqtlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f4wA (A:)
    tatqrlkqdylrikkdpvpyicaeplpsnilewhyvvrgpemtpyeggyyhgklifpref
    pfkppsiymitpngrfkcntrlcwnpawsvstiltgllsfmvekgptlgsietsdftkrq
    lavqslafnlkdkvfcelfpevveeik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f4wB (B:)
    gsmsstsskrapttatqrlkqdylrikkdpvpyicaeplpsnilewhyvvrgpemtpyeg
    gyyhgklifprefpfkppsiymitpngrfkcntrlclsitdfhpdtwnpawsvstiltgl
    lsfmvekgptlgsietsdftkrqlavqslafnlkdkvfcelfpevveeikqkqkaqdels
    srpqtlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f4wB (B:)
    ttatqrlkqdylrikkdpvpyicaeplpsnilewhyvvrgpemtpyeggyyhgklifpre
    fpfkppsiymitpngrfkcntrlclwnpawsvstiltgllsfmvekgptlgsietsdftk
    rqlavqslafnlkdkvfcelfpevveeikqkq