PDB entry 2f4o

View 2f4o on RCSB PDB site
Description: The Mouse PNGase-HR23 Complex Reveals a Complete Remodulation of the Protein-Protein Interface Compared to its Yeast Orthologs
Class: hydrolase/hydrolase inhibitor
Keywords: glycoproteins, ubiquitin-dependent protein degradation, nucleotide excision repair, peptide:n-glycanase, transglutaminase, hydrolase-hydrolase inhibitor complex
Deposited on 2005-11-23, released 2006-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptide N-glycanase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAP03060 (0-End)
      • expression tag (289-294)
    Domains in SCOPe 2.07: d2f4oa2, d2f4oa3
  • Chain 'B':
    Compound: XP-C repair complementing complex 58 kDa protein
    Species: Mus musculus [TaxId:10090]
    Gene: Rad23b, Mhr23b
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54728 (0-59)
      • cloning artifact (60)
    Domains in SCOPe 2.07: d2f4ob2, d2f4ob3
  • Chain 'I':
    Compound: phq-val-ala-asp-cf0
    Database cross-references and differences (RAF-indexed):
    • PDB 2F4O (0-4)
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f4oA (A:)
    gdstilkvlqsniqhvqlyenpvlqekaltcipvselkrkaqeklfrarkldkgtnvsde
    dflllellhwfkeeffrwvnnivcskcggetrsrdeallpnddelkwgaknvenhycdac
    qlsnrfprynnpeklletrcgrcgewancftlccralgfearyvwdytdhvwtevyspsq
    qrwlhcdacedvcdkpllyeigwgkklsyiiafskdevvdvtwrysckhdevmsrrtkvk
    eellretinglnkqrqlslsesrrkellqriivelvefispktprpglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f4oA (A:)
    gdstilkvlqsniqhvqlyenpvlqekaltcipvselkrkaqeklfrarkldkgtnvsde
    dflllellhwfkeeffrwvnnivcskcggetrsrdeallpnddelkwgaknvenhycdac
    qlsnrfprynnpeklletrcgrcgewancftlccralgfearyvwdytdhvwtevyspsq
    qrwlhcdacedvcdkpllyeigwgkklsyiiafskdevvdvtwrysckhdevmsrrtkvk
    eellretinglnkqrqlslsesrrkellqriivelvefispktphhhhhh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f4oB (B:)
    ghpleflrnqpqfqqmrqiiqqnpsllpallqqigrenpqllqqisqhqehfiqmlnepv
    g
    

  • Chain 'I':
    No sequence available.