PDB entry 2f4m

View 2f4m on RCSB PDB site
Description: The Mouse PNGase-HR23 Complex Reveals a Complete Remodulation of the Protein-Protein Interface Compared to its Yeast Orthologs
Class: hydrolase
Keywords: Glycoproteins, Ubiquitin-dependent protein degradation, Nucleotide excision repair, Peptide:N-glycanase, Transglutaminase, HYDROLASE
Deposited on 2005-11-23, released 2006-03-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.189
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptide N-glycanase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JI78 (0-286)
      • cloning artifact (287-288)
      • expression tag (289-294)
    Domains in SCOPe 2.01: d2f4ma1
  • Chain 'B':
    Compound: UV excision repair protein RAD23 homolog B
    Species: Mus musculus [TaxId:10090]
    Gene: Rad23b, Mhr23b
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54728 (0-59)
      • cloning artifact (60)
    Domains in SCOPe 2.01: d2f4mb_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f4mA (A:)
    gdstilkvlqsniqhvqlyenpvlqekaltcipvselkrkaqeklfrarkldkgtnvsde
    dflllellhwfkeeffrwvnnivcskcggetrsrdeallpnddelkwgaknvenhycdac
    qlsnrfprynnpeklletrcgrcgewancftlccralgfearyvwdytdhvwtevyspsq
    qrwlhcdacedvcdkpllyeigwgkklsyiiafskdevvdvtwrysckhdevmsrrtkvk
    eellretinglnkqrqlslsesrrkellqriivelvefispktprpglehhhhhh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f4mB (B:)
    ghpleflrnqpqfqqmrqiiqqnpsllpallqqigrenpqllqqisqhqehfiqmlnepv
    g