PDB entry 2f4l

View 2f4l on RCSB PDB site
Description: Crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 A resolution
Class: hydrolase
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, hydrolase
Deposited on 2005-11-23, released 2005-12-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetamidase, putative
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm0119
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXX3 (12-End)
      • modified residue (12)
      • modified residue (28)
      • modified residue (92)
      • modified residue (133)
      • modified residue (158)
      • modified residue (189)
      • modified residue (264)
    Domains in SCOPe 2.05: d2f4la1
  • Chain 'B':
    Compound: acetamidase, putative
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm0119
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXX3 (12-End)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (28)
      • modified residue (92)
      • modified residue (133)
      • modified residue (158)
      • modified residue (189)
      • modified residue (264)
    Domains in SCOPe 2.05: d2f4lb_
  • Chain 'C':
    Compound: acetamidase, putative
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm0119
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXX3 (12-End)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (28)
      • modified residue (92)
      • modified residue (133)
      • modified residue (158)
      • modified residue (189)
      • modified residue (264)
    Domains in SCOPe 2.05: d2f4lc_
  • Chain 'D':
    Compound: acetamidase, putative
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm0119
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXX3 (12-End)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (28)
      • modified residue (92)
      • modified residue (133)
      • modified residue (158)
      • modified residue (189)
      • modified residue (264)
    Domains in SCOPe 2.05: d2f4ld_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f4lA (A:)
    mgsdkihhhhhhmkvvpaqrcvysfsanmapveevypgeqvvfetldalggsydkidfsk
    vnpatgpvfvngvkpgdtlkvrikrielprrgmivtgkgfgvlgdevegfhtkeleiekw
    avlfdgvripihpmvgvigvapqegeyptgtahrhggnmdtkeitenvtvhlpvfqegal
    lalgdvhatmgdgevcvsacevpakvvveidvskeeikwpvvetndayyiivslpdieea
    lkevtretvwfiqrrktipftdaymlaslsvdvgisqlvnpaktakaripkyiftgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f4lA (A:)
    mkvvpaqrcvysfsanmapveevypgeqvvfetldalgskvnpatgpvfvngvkpgdtlk
    vrikrielprrgmivtgkgfgvlgdevegfhtkeleiekwavlfdgvripihpmvgvigv
    apqegeyptgtahrhggnmdtkeitenvtvhlpvfqegallalgdvhatmgdgevcvsac
    evpakvvveidvskeeikwpvvetndayyiivslpdieealkevtretvwfiqrrktipf
    tdaymlaslsvdvgisqlvnpaktakaripkyift
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f4lB (B:)
    mgsdkihhhhhhmkvvpaqrcvysfsanmapveevypgeqvvfetldalggsydkidfsk
    vnpatgpvfvngvkpgdtlkvrikrielprrgmivtgkgfgvlgdevegfhtkeleiekw
    avlfdgvripihpmvgvigvapqegeyptgtahrhggnmdtkeitenvtvhlpvfqegal
    lalgdvhatmgdgevcvsacevpakvvveidvskeeikwpvvetndayyiivslpdieea
    lkevtretvwfiqrrktipftdaymlaslsvdvgisqlvnpaktakaripkyiftgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f4lB (B:)
    hmkvvpaqrcvysfsanmapveevypgeqvvfetldalvnpatgpvfvngvkpgdtlkvr
    ikrielprrgmivtgkgfgvlgdevegfhtkeleiekwavlfdgvripihpmvgvigvap
    qegeyptgtahrhggnmdtkeitenvtvhlpvfqegallalgdvhatmgdgevcvsacev
    pakvvveidvskeeikwpvvetndayyiivslpdieealkevtretvwfiqrrktipftd
    aymlaslsvdvgisqlvnpaktakaripkyift
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f4lC (C:)
    mgsdkihhhhhhmkvvpaqrcvysfsanmapveevypgeqvvfetldalggsydkidfsk
    vnpatgpvfvngvkpgdtlkvrikrielprrgmivtgkgfgvlgdevegfhtkeleiekw
    avlfdgvripihpmvgvigvapqegeyptgtahrhggnmdtkeitenvtvhlpvfqegal
    lalgdvhatmgdgevcvsacevpakvvveidvskeeikwpvvetndayyiivslpdieea
    lkevtretvwfiqrrktipftdaymlaslsvdvgisqlvnpaktakaripkyiftgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f4lC (C:)
    hmkvvpaqrcvysfsanmapveevypgeqvvfetldalggsskvnpatgpvfvngvkpgd
    tlkvrikrielprrgmivtgkgfgvlgdevegfhtkeleiekwavlfdgvripihpmvgv
    igvapqegeyptgtahrhggnmdtkeitenvtvhlpvfqegallalgdvhatmgdgevcv
    sacevpakvvveidvskeeikwpvvetndayyiivslpdieealkevtretvwfiqrrkt
    ipftdaymlaslsvdvgisqlvnpaktakaripkyift
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2f4lD (D:)
    mgsdkihhhhhhmkvvpaqrcvysfsanmapveevypgeqvvfetldalggsydkidfsk
    vnpatgpvfvngvkpgdtlkvrikrielprrgmivtgkgfgvlgdevegfhtkeleiekw
    avlfdgvripihpmvgvigvapqegeyptgtahrhggnmdtkeitenvtvhlpvfqegal
    lalgdvhatmgdgevcvsacevpakvvveidvskeeikwpvvetndayyiivslpdieea
    lkevtretvwfiqrrktipftdaymlaslsvdvgisqlvnpaktakaripkyiftgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f4lD (D:)
    hmkvvpaqrcvysfsanmapveevypgeqvvfetldalgvnpatgpvfvngvkpgdtlkv
    rikrielprrgmivtgkgfgvlgdevegfhtkeleiekwavlfdgvripihpmvgvigva
    pqegeyptgtahrhggnmdtkeitenvtvhlpvfqegallalgdvhatmgdgevcvsace
    vpakvvveidvskeeikwpvvetndayyiivslpdieealkevtretvwfiqrrktipft
    daymlaslsvdvgisqlvnpaktakaripkyift