PDB entry 2f4j

View 2f4j on RCSB PDB site
Description: Structure of the Kinase Domain of an Imatinib-Resistant Abl Mutant in Complex with the Aurora Kinase Inhibitor VX-680
Class: transferase
Keywords: kinase, kinase inhibitor, abl, TRANSFERASE
Deposited on 2005-11-23, released 2006-01-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed):
    • GB NP_005148 (0-286)
      • engineered (169)
      • cloning artifact (1)
    Domains in SCOPe 2.08: d2f4ja_
  • Heterogens: VX6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2f4jA (A:)
gmspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflke
aavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatq
issameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytapagakfpikwt
apeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpe
kvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkq