PDB entry 2f4f

View 2f4f on RCSB PDB site
Description: Crystal structure of IS200 transposase
Class: gene regulation
Keywords: Mn complex, GENE REGULATION
Deposited on 2005-11-23, released 2005-12-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.222
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transposase, putative
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2f4fa1
  • Chain 'B':
    Compound: Transposase, putative
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2f4fb_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f4fA (A:)
    melkstrhtkylcnyhfvwipkhrrntlvneiaeytkevlksiaeelgceiialevmpdh
    ihlfvncppryapsylanyfkgksarlilkkfpqlnkgklwtrsyfvatagnvssevikk
    yieeqwrkegeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f4fA (A:)
    elkstrhtkylcnyhfvwipkhrrntlvneiaeytkevlksiaeelgceiialevmpdhi
    hlfvncppryapsylanyfkgksarlilkkfpqlnkgklwtrsyfvatagnvssevikky
    ieeqwrkege
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f4fB (B:)
    melkstrhtkylcnyhfvwipkhrrntlvneiaeytkevlksiaeelgceiialevmpdh
    ihlfvncppryapsylanyfkgksarlilkkfpqlnkgklwtrsyfvatagnvssevikk
    yieeqwrkegeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f4fB (B:)
    elkstrhtkylcnyhfvwipkhrrntlvneiaeytkevlksiaeelgceiialevmpdhi
    hlfvncppryapsylanyfkgksarlilkkfpqlnkgklwtrsyfvatagnvssevikky
    ieeqwrkege