PDB entry 2f48

View 2f48 on RCSB PDB site
Description: Crystal Structure of A Novel Fructose 1,6-Bisphosphate and AlF3 containing Pyrophosphate-dependent Phosphofructo-1-kinase Complex from Borrelia burgdorferi
Class: transferase
Keywords: phosphotransfer, TRANSFERASE
Deposited on 2005-11-22, released 2006-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.203
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphosphate--fructose-6-phosphate 1-phosphotransferase
    Species: Borrelia burgdorferi [TaxId:224326]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f48a_
  • Chain 'B':
    Compound: diphosphate--fructose-6-phosphate 1-phosphotransferase
    Species: Borrelia burgdorferi [TaxId:224326]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f48b_
  • Heterogens: FBP, AF3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f48A (A:)
    mntslfkqerqkyipklpnilkkdfnnislvygenteaiqdrqalkeffkntyglpiisf
    tegesslsfskalnigiilsggpapgghnvisgvfdaikkfnpnsklfgfkggplgllen
    dkielteslinsyrntggfdivssgrtkieteehynkalfvakennlnaiiiiggddsnt
    naailaeyfkkngeniqvigvpktidadlrndhieisfgfdsatkiyselignlcrdams
    tkkywhfvklmgrsashvalecalkthpnicivseevlakkktlseiidemvsvilkrsl
    ngdnfgvvivpegliefipevkslmlelcdifdknegefkglniekmkeifvaklsdymk
    gvylslplfiqfeliksilerdphgnfnvsrvpteklfiemiqsrlndmkkrgeykgsft
    pvdhffgyegrsafpsnfdsdycyslgynavvlilngltgymsciknlnlkptdwiaggv
    pltmlmnmeerygekkpvikkalvdlegrpfkefvknrdkwalnnlylypgpvqyfgsse
    ivdeitetlklelfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f48A (A:)
    slfkqerqkyipklpnilkkdfnnislvygenteaiqdrqalkeffkntyglpiisfteg
    esslsfskalnigiilsggpapgghnvisgvfdaikkfnpnsklfgfkggplgllendki
    elteslinsyrntggfdivssgrtkieteehynkalfvakennlnaiiiiggddsntnaa
    ilaeyfkkngeniqvigvpktidadlrndhieisfgfdsatkiyselignlcrdamstkk
    ywhfvklmgrsashvalecalkthpnicivseevlakkktlseiidemvsvilkrslngd
    nfgvvivpegliefipevkslmlelcdifdknegefkglniekmkeifvaklsdymkgvy
    lslplfiqfeliksilerdphgnfnvsrvpteklfiemiqsrlndmkkrgeykgsftpvd
    hffgyegrsafpsnfdsdycyslgynavvlilngltgymsciknlnlkptdwiaggvplt
    mlmnmeerygekkpvikkalvdlegrpfkefvknrdkwalnnlylypgpvqyfgsseivd
    eitetlklelf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f48B (B:)
    mntslfkqerqkyipklpnilkkdfnnislvygenteaiqdrqalkeffkntyglpiisf
    tegesslsfskalnigiilsggpapgghnvisgvfdaikkfnpnsklfgfkggplgllen
    dkielteslinsyrntggfdivssgrtkieteehynkalfvakennlnaiiiiggddsnt
    naailaeyfkkngeniqvigvpktidadlrndhieisfgfdsatkiyselignlcrdams
    tkkywhfvklmgrsashvalecalkthpnicivseevlakkktlseiidemvsvilkrsl
    ngdnfgvvivpegliefipevkslmlelcdifdknegefkglniekmkeifvaklsdymk
    gvylslplfiqfeliksilerdphgnfnvsrvpteklfiemiqsrlndmkkrgeykgsft
    pvdhffgyegrsafpsnfdsdycyslgynavvlilngltgymsciknlnlkptdwiaggv
    pltmlmnmeerygekkpvikkalvdlegrpfkefvknrdkwalnnlylypgpvqyfgsse
    ivdeitetlklelfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f48B (B:)
    tslfkqerqkyipklpnilkkdfnnislvygenteaiqdrqalkeffkntyglpiisfte
    gesslsfskalnigiilsggpapgghnvisgvfdaikkfnpnsklfgfkggplgllendk
    ielteslinsyrntggfdivssgrtkieteehynkalfvakennlnaiiiiggddsntna
    ailaeyfkkngeniqvigvpktidadlrndhieisfgfdsatkiyselignlcrdamstk
    kywhfvklmgrsashvalecalkthpnicivseevlakkktlseiidemvsvilkrslng
    dnfgvvivpegliefipevkslmlelcdifdknegefkglniekmkeifvaklsdymkgv
    ylslplfiqfeliksilerdphgnfnvsrvpteklfiemiqsrlndmkkrgeykgsftpv
    dhffgyegrsafpsnfdsdycyslgynavvlilngltgymsciknlnlkptdwiaggvpl
    tmlmnmeerygekkpvikkalvdlegrpfkefvknrdkwalnnlylypgpvqyfgsseiv
    deitetlklelf