PDB entry 2f44

View 2f44 on RCSB PDB site
Description: Crystal Structure of the Zinc-bound Shank SAM domain
Class: structural protein
Keywords: Post-synaptic density, SAM domain, Shank, scaffolding protein, Zinc, STRUCTURAL PROTEIN
Deposited on 2005-11-22, released 2006-02-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.252
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 and multiple ankyrin repeat domains 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Shank3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLU4 (1-End)
      • initiating methionine (0)
      • engineered (55)
    Domains in SCOPe 2.02: d2f44a_
  • Chain 'B':
    Compound: SH3 and multiple ankyrin repeat domains 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Shank3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLU4 (1-End)
      • engineered (55)
    Domains in SCOPe 2.02: d2f44b_
  • Chain 'C':
    Compound: SH3 and multiple ankyrin repeat domains 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Shank3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLU4 (1-End)
      • engineered (55)
    Domains in SCOPe 2.02: d2f44c_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f44A (A:)
    mlqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghrenier
    alrqldgsrrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f44A (A:)
    mlqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghrenier
    alrql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f44B (B:)
    mlqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghrenier
    alrqldgsrrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f44B (B:)
    lqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghreniera
    lrql
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f44C (C:)
    mlqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghrenier
    alrqldgsrrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f44C (C:)
    lqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghreniera
    lr