PDB entry 2f43

View 2f43 on RCSB PDB site
Description: Rat liver F1-ATPase
Class: hydrolase
Keywords: ATP synthase, f0f1-ATPase, oxidative phosphorylation, mitochondria, hydrolase, vanadate
Deposited on 2005-11-22, released 2006-03-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.306
AEROSPACI score: -1.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase alpha chain, mitochondrial
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2f43a1, d2f43a2, d2f43a3
  • Chain 'B':
    Compound: ATP synthase beta chain, mitochondrial
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2f43b1, d2f43b2, d2f43b3
  • Chain 'G':
    Compound: ATP synthase gamma chain, mitochondrial
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2f43g1
  • Heterogens: VO4, MG, ATP, ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f43A (A:)
    qktgtaemssileerilgadtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglk
    gmslnlepdnvgvvvfgndklikegdivkrtgaivdvpvgdellgrvvdalgnaidgkgp
    vgskirrrvglkapgiiprisvrepmqtgikavdslvpigrgqreliigdrqtgktsiai
    dtiinqkrfndgtdekkklyciyvaigqkrstvaqlvkrltdadamkytivvsatasdaa
    plqylapysgcsmgeyfrdngkhaliiyddlskqavayrqmslllrrppgreaypgdvfy
    lhsrlleraakmndsfgggsltalpvietqagdvsayiptnvisitdgqifletelfykg
    irpainvglsvsrvgsaaqtramkqvagtmklelaqyrevaafaqfgsdldaatqqllsr
    gvrltellkqgqyspmaieeqvaviyagvrgyldklepskitkfesaflshvvsqhqsll
    gnirsdgkiseqsdaklkeivtnflagfep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f43A (A:)
    vdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndkli
    kegdivkrtgaivdvpvgdellgrvvdalgnaidgkgpvgskirrrvglkapgiiprisv
    repmqtgikavdslvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyci
    yvaigqkrstvaqlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngk
    haliiyddlskqavayrqmslllrrppgreaypgdvfylhsrlleraakmndsfgggslt
    alpvietqagdvsayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaqtra
    mkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaieeqv
    aviyagvrgyldklepskitkfesaflshvvsqhqsllgnirsdgkiseqsdaklkeivt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f43B (B:)
    saapkagtatgqivavigavvdvqfdeglppilnalevqgresrlvlevaqhlgestvrt
    iamdgteglvrgqkvldsgapikipvgpetlgrimnvigepidergpiktkqfapihaea
    pefiemsveqeilvtgikvvdllapyakggkiglfggagvgktvlimelinnvakahggy
    svfagvgertregndlyhemiesgvinlkdatskvalvygqmneppgararvaltgltva
    eyfrdqegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgtmqeritttk
    kgsitsvqaiyvpaddltdpapattfahldattvlsraiaelgiypavdpldstsrimdp
    nivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqpfqv
    aevftghmgklvplketikgfqqilagdydhlpeqafymvgpieeavakadklaeehgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f43B (B:)
    saapkagtatgqivavigavvdvqfdeglppilnalevqgresrlvlevaqhlgestvrt
    iamdgteglvrgqkvldsgapikipvgpetlgrimnvigepidergpiktkqfapihaea
    pefiemsveqeilvtgikvvdllapyakggkiglfggagvgktvlimelinnvakahggy
    svfagvgertregndlyhemiesgvinlkdatskvalvygqmneppgararvaltgltva
    eyfrdqegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgtmqeritttk
    kgsitsvqaiyvpaddltdpapattfahldattvlsraiaelgiypavdpldstsrimdp
    nivgsehydvargvqkilqdykslqdiiailgmdelseerarkiqrflsqpfqvaevftg
    hmgklvplketikgfqqilagdydhlpeqafymvgpieeavakadklaeeh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2f43G (G:)
    atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygtgslalyekaeikgp
    edkkkhliigvssdrglcgaihssvakqmkndmaaltaagkevmivgigekiksilyrth
    sdqflvsfkdvgrkpptfgdasvialellnsgyefdegsiifnqfksvisykteekpifs
    fstvvaaenmsiyddidadvlqnyqeynlaniiyyslkesttseqsarmtamdnasknas
    dmidkltltfnrtrqavitkelieiisgaaald
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f43G (G:)
    kditrrlksikniqkitksmkmvaaakyaraerelkparvygtgslcgaihssvakqmkl
    aniiyyslkesttseqsarmtamdnasknasdmidkltltfnrtrqavitkelieiisga
    aald