PDB entry 2f41

View 2f41 on RCSB PDB site
Description: Crystal structure of FapR- a global regulator of fatty acid biosynthesis in B. subtilis
Class: gene regulation
Keywords: 'hot-dog' fold, GENE REGULATION
Deposited on 2005-11-22, released 2006-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor fapR
    Species: Bacillus subtilis [TaxId:1423]
    Gene: fapR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f41a1
  • Chain 'B':
    Compound: Transcription factor fapR
    Species: Bacillus subtilis [TaxId:1423]
    Gene: fapR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f41b_
  • Chain 'C':
    Compound: Transcription factor fapR
    Species: Bacillus subtilis [TaxId:1423]
    Gene: fapR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f41c_
  • Chain 'D':
    Compound: Transcription factor fapR
    Species: Bacillus subtilis [TaxId:1423]
    Gene: fapR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f41d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f41A (A:)
    slsldevigeiidlelddqaisileikqehvfsrnqiarghhlfaqanslavaviddela
    ltasadirftrqvkqgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmyrskh
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f41A (A:)
    evigeiidlelddqaisileikqehvfsrnqiarghhlfaqanslavavilaltasadir
    ftrqvkqgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f41B (B:)
    slsldevigeiidlelddqaisileikqehvfsrnqiarghhlfaqanslavaviddela
    ltasadirftrqvkqgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmyrskh
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f41B (B:)
    evigeiidlelddqaisileikqehvfsrnqiarghhlfaqanslavavilaltasadir
    ftrqvkqgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmyr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f41C (C:)
    slsldevigeiidlelddqaisileikqehvfsrnqiarghhlfaqanslavaviddela
    ltasadirftrqvkqgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmyrskh
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f41C (C:)
    evigeiidlelddqaisileikqehvarghhlfaqanslavavilaltasadirftrqvk
    qgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmyr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2f41D (D:)
    slsldevigeiidlelddqaisileikqehvfsrnqiarghhlfaqanslavaviddela
    ltasadirftrqvkqgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmyrskh
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f41D (D:)
    evigeiidlelddqaisileikqehvfsrnqiarghhlfaqanslavavilaltasadir
    ftrqvkqgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmy