PDB entry 2f40

View 2f40 on RCSB PDB site
Description: Structure of a Novel Protein from Backbone-Centered NMR Data and NMR-Assisted Structure Prediction
Class: structural genomics, unknown function
Keywords: protein structure prediction, residual dipolar couplings, Pyrococcus furious, simulated annealing, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, UNKNOWN FUNCTION
Deposited on 2005-11-22, released 2005-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein PF1455
  Species: Pyrococcus furiosus [TaxId:186497]
  Database cross-references and differences (RAF-indexed):
  • GB NP_579184 (9-End)
    • expression tag (8)
  Domains in SCOPe 2.07: d2f40a1, d2f40a2

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2f40A (A:)
  ahhhhhhgskwikfttnltpeeakivqyelstrdefyrvfinpyakvaevviddskvnie
  elkeklkgevieekeitlqeliegslswnnvlrska
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2f40A (A:)
  skwikfttnltpeeakivqyelstrdefyrvfinpyakvaevviddskvnieelkeklkg
  evieekeitlqeli