PDB entry 2f3x

View 2f3x on RCSB PDB site
Description: Crystal structure of FapR (in complex with effector)- a global regulator of fatty acid biosynthesis in B. subtilis
Class: gene regulation
Keywords: 'hot-dog' fold / malonyl-CoA complex, GENE REGULATION
Deposited on 2005-11-22, released 2006-10-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.19
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor fapR
    Species: Bacillus subtilis [TaxId:1423]
    Gene: fapR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2f3xa1
  • Chain 'B':
    Compound: Transcription factor fapR
    Species: Bacillus subtilis [TaxId:1423]
    Gene: fapR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2f3xb1
  • Heterogens: MLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f3xA (A:)
    mrgshhhhhhgselsipelreriknvaektledevkslsldevigeiidlelddqaisil
    eikqehvfsrnqiarghhlfaqanslavaviddelaltasadirftrqvkqgervvakak
    vtavekekgrtvvevnsyvgeeivfsgrfdmyrskhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3xA (A:)
    elsipelreriknvaektledevkslsldevigeiidlelddqaisileikqehvfsrnq
    iarghhlfaqanslavaviddelaltasadirftrqvkqgervvakakvtavekekgrtv
    vevnsyvgeeivfsgrfdmyrsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f3xB (B:)
    mrgshhhhhhgselsipelreriknvaektledevkslsldevigeiidlelddqaisil
    eikqehvfsrnqiarghhlfaqanslavaviddelaltasadirftrqvkqgervvakak
    vtavekekgrtvvevnsyvgeeivfsgrfdmyrskhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3xB (B:)
    elsipelreriknvaektledevkslsldevigeiidlelddqaisileikqehvfsrnq
    iarghhlfaqanslavaviddelaltasadirftrqvkqgervvakakvtavekekgrtv
    vevnsyvgeeivfsgrfdmyrsk