PDB entry 2f3v

View 2f3v on RCSB PDB site
Description: Solution structure of 1-110 fragment of staphylococcal nuclease with V66W mutation
Class: hydrolase
Keywords: OB-Fold, HYDROLASE
Deposited on 2005-11-22, released 2006-12-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Thermonuclease
  Species: Staphylococcus aureus [TaxId:1280]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00644 (0-109)
    • engineered (65)
  Domains in SCOPe 2.08: d2f3va_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2f3vA (A:)
  atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
  ftkkmwenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglak