PDB entry 2f3t

View 2f3t on RCSB PDB site
Description: Crystal Structure Of E.coli Guanylate Kinase In Complex With Ganciclovir monophosphate
Class: transferase
Keywords: transferase, gmp kinase, guanylate kinase, nucleotide analogue
Deposited on 2005-11-22, released 2006-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.16 Å
R-factor: 0.268
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: gmk, spoR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f3ta_
  • Chain 'B':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: gmk, spoR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f3tb_
  • Chain 'C':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: gmk, spoR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f3tc_
  • Chain 'D':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: gmk, spoR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f3td_
  • Chain 'E':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: gmk, spoR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f3te_
  • Chain 'F':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: gmk, spoR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f3tf_
  • Heterogens: LGP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f3tA (A:)
    maqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhd
    efkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmphars
    ifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlk
    tiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3tA (A:)
    aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
    fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
    filppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkt
    iiraerlrmsrqkqrhdalisklla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f3tB (B:)
    maqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhd
    efkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmphars
    ifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlk
    tiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3tB (B:)
    aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
    fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
    filppskieldrrlrgrseeviakrmaqavaemshyaeydylivnddfdtaltdlktiir
    aerlrmsrqkqrhdaliskllad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f3tC (C:)
    maqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhd
    efkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmphars
    ifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlk
    tiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3tC (C:)
    aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
    fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
    filppskieldrrlrdseeviakrmaqavaemshyaeydylivnddfdtaltdlktiira
    erlrmsrqkqrhdalisklla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2f3tD (D:)
    maqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhd
    efkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmphars
    ifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlk
    tiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3tD (D:)
    aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
    fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
    filppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkt
    iiraerlrmsrqkqrhdalisklla
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2f3tE (E:)
    maqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhd
    efkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmphars
    ifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlk
    tiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3tE (E:)
    aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
    fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
    filppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkt
    iiraerlrmsrqkqrhdaliskll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2f3tF (F:)
    maqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhd
    efkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmphars
    ifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlk
    tiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3tF (F:)
    aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
    fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
    filppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkt
    iiraerlrmsrqkqrhdalisklla