PDB entry 2f3r

View 2f3r on RCSB PDB site
Description: Crystal Structure Of E.coli Guanylate Kinase In Complex With Ap5G
Class: transferase
Keywords: transferase, gmp kinase, guanylate kinase, nucleotide analogue
Deposited on 2005-11-22, released 2006-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.211
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: gmk, spoR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f3ra_
  • Chain 'B':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: gmk, spoR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f3rb_
  • Heterogens: G5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f3rA (A:)
    maqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhd
    efkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmphars
    ifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlk
    tiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3rA (A:)
    aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
    fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
    filppskieldrrlrgseeviakrmaqavaemshyaeydylivnddfdtaltdlktiira
    erlrmsrqkqrhdalisklla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f3rB (B:)
    maqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhd
    efkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmphars
    ifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlk
    tiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3rB (B:)
    aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
    fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
    filppskieldrrlrgseeviakrmaqavaemshyaeydylivnddfdtaltdlktiira
    erlrmsrqkqrhdaliskl