PDB entry 2f3o

View 2f3o on RCSB PDB site
Description: Crystal Structure of a glycyl radical enzyme from Archaeoglobus fulgidus
Class: unknown function
Keywords: pyruvate formate lyase, glycerol dehydratase, PFL2, glycyl radical, hyperthermophilic, unknown function
Deposited on 2005-11-22, released 2006-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.202
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate formate-lyase 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF1449, PFLD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f3oa_
  • Chain 'B':
    Compound: pyruvate formate-lyase 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF1449, PFLD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f3ob_
  • Heterogens: PGE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f3oA (A:)
    mcmdrieklikkvskparlsvercrlytesmkqtegepmiirqakalkhvlenipiqild
    selivgtmlpnppgaiifpegvglriineldslpnretnrlmvdeedakvlreeiapywq
    rktieafafplmpdimqilytgsvfvlteiagishvavnypyllrrgfrwfleeserrir
    aleesgvyegekysfyqaakivseavinyglrysklaeelaesedgerreellkiaeicr
    kvpaekpetfweavqfvwlvqsalhqenyeqaismgridqylypffkkdigegrinrela
    fdilanlwiktneivpafdslleqyfsgqatnqavtiggcdiygndatneltylmlevtd
    rlrlrqpnvhvrinkgspesflkrlaeaissgcnnlalffddaavkalknaevddrdaln
    yttdgcveiapfgnsftssdaalinvakaleyalnegvdlqfgyefgaktekpkfledll
    eklreqvshivklvvrgsnvlsyanaevkptpllslcvedcfekgvdvsrggarynftgi
    qavgiadvgdslvaiegalnagysmddiveacrknfvgyeklhklllqspkygndddaad
    kytkmvlewyceevnrhrnfrggkfaagcypmttnvgfgfftsalpsgrksgeplnpgvs
    pstgmdregvtavinsasklsyenlpngasltinlssdvlgekgdaviealikssmelgv
    mhvqfnilkedllrkaqqepekyrwllvrvagwsayfvelsrpvqeevirriscri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3oA (A:)
    drieklikkvskparlsvercrlytesmkqtegepmiirqakalkhvlenipiqildsel
    ivgtmlpnppgaiifpegvglriineldslpnretnrlmvdeedakvlreeiapywqrkt
    ieafafplmpdimqilytgsvfvlteiagishvavnypyllrrgfrwfleeserrirale
    esgvyegekysfyqaakivseavinyglrysklaeelaesedgerreellkiaeicrkvp
    aekpetfweavqfvwlvqsalhqenyeqaismgridqylypffkkdigegrinrelafdi
    lanlwiktneivpafdslleqyfsgqatnqavtiggcdiygndatneltylmlevtdrlr
    lrqpnvhvrinkgspesflkrlaeaissgcnnlalffddaavkalknaevddrdalnytt
    dgcveiapfgnsftssdaalinvakaleyalnegvdlqfgyefgaktekpkfledllekl
    reqvshivklvvrgsnvlsyanaevkptpllslcvedcfekgvdvsrggarynftgiqav
    giadvgdslvaiegalnagysmddiveacrknfvgyeklhklllqspkygndddaadkyt
    kmvlewyceevnrhrnfrggkfaagcypmttnvgfgfftsalpsgrksgeplnpgvspst
    gmdregvtavinsasklsyenlpngasltinlssdvlgekgdaviealikssmelgvmhv
    qfnilkedllrkaqqepekyrwllvrvagwsayfvelsrpvqeevirriscri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f3oB (B:)
    mcmdrieklikkvskparlsvercrlytesmkqtegepmiirqakalkhvlenipiqild
    selivgtmlpnppgaiifpegvglriineldslpnretnrlmvdeedakvlreeiapywq
    rktieafafplmpdimqilytgsvfvlteiagishvavnypyllrrgfrwfleeserrir
    aleesgvyegekysfyqaakivseavinyglrysklaeelaesedgerreellkiaeicr
    kvpaekpetfweavqfvwlvqsalhqenyeqaismgridqylypffkkdigegrinrela
    fdilanlwiktneivpafdslleqyfsgqatnqavtiggcdiygndatneltylmlevtd
    rlrlrqpnvhvrinkgspesflkrlaeaissgcnnlalffddaavkalknaevddrdaln
    yttdgcveiapfgnsftssdaalinvakaleyalnegvdlqfgyefgaktekpkfledll
    eklreqvshivklvvrgsnvlsyanaevkptpllslcvedcfekgvdvsrggarynftgi
    qavgiadvgdslvaiegalnagysmddiveacrknfvgyeklhklllqspkygndddaad
    kytkmvlewyceevnrhrnfrggkfaagcypmttnvgfgfftsalpsgrksgeplnpgvs
    pstgmdregvtavinsasklsyenlpngasltinlssdvlgekgdaviealikssmelgv
    mhvqfnilkedllrkaqqepekyrwllvrvagwsayfvelsrpvqeevirriscri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3oB (B:)
    drieklikkvskparlsvercrlytesmkqtegepmiirqakalkhvlenipiqildsel
    ivgtmlpnppgaiifpegvglriineldslpnretnrlmvdeedakvlreeiapywqrkt
    ieafafplmpdimqilytgsvfvlteiagishvavnypyllrrgfrwfleeserrirale
    esgvyegekysfyqaakivseavinyglrysklaeelaesedgerreellkiaeicrkvp
    aekpetfweavqfvwlvqsalhqenyeqaismgridqylypffkkdigegrinrelafdi
    lanlwiktneivpafdslleqyfsgqatnqavtiggcdiygndatneltylmlevtdrlr
    lrqpnvhvrinkgspesflkrlaeaissgcnnlalffddaavkalknaevddrdalnytt
    dgcveiapfgnsftssdaalinvakaleyalnegvdlqfgyefgaktekpkfledllekl
    reqvshivklvvrgsnvlsyanaevkptpllslcvedcfekgvdvsrggarynftgiqav
    giadvgdslvaiegalnagysmddiveacrknfvgyeklhklllqspkygndddaadkyt
    kmvlewyceevnrhrnfrggkfaagcypmttnvgfgfftsalpsgrksgeplnpgvspst
    gmdregvtavinsasklsyenlpngasltinlssdvlgekgdaviealikssmelgvmhv
    qfnilkedllrkaqqepekyrwllvrvagwsayfvelsrpvqeevirriscri