PDB entry 2f3n

View 2f3n on RCSB PDB site
Description: Crystal Structure of the native Shank SAM domain.
Class: structural protein
Keywords: Postsynaptic density, SAM domain, shank, scaffolding protein
Deposited on 2005-11-22, released 2006-02-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 and multiple ankyrin repeat domains 3
    Species: Rattus norvegicus
    Gene: Shank3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLU4 (1-End)
      • initiating methionine (0)
      • engineered (55)
    Domains in SCOP 1.73: d2f3na1
  • Chain 'B':
    Compound: SH3 and multiple ankyrin repeat domains 3
    Species: Rattus norvegicus
    Gene: Shank3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLU4 (1-End)
      • engineered (55)
    Domains in SCOP 1.73: d2f3nb1
  • Chain 'C':
    Compound: SH3 and multiple ankyrin repeat domains 3
    Species: Rattus norvegicus
    Gene: Shank3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLU4 (1-End)
      • engineered (55)
    Domains in SCOP 1.73: d2f3nc1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f3nA (A:)
    mlqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghrenier
    alrqldgsrrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3nA (A:)
    mlqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghrenier
    alrql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f3nB (B:)
    mlqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghrenier
    alrqldgsrrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3nB (B:)
    lqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghreniera
    lrql
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f3nC (C:)
    mlqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghrenier
    alrqldgsrrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3nC (C:)
    lqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghreniera
    lr