PDB entry 2f3l

View 2f3l on RCSB PDB site
Description: Crystal Structure of a Lumenal Rfr-domain protein (Contig83.1_1_243_746) from Cyanothece sp. 51142 at 2.1 Angstrom resolution.
Class: unknown function
Keywords: Beta Helix, UNKNOWN FUNCTION
Deposited on 2005-11-21, released 2006-11-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.217
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RFR-Domain
    Species: Cyanothece sp. ATCC 51142 [TaxId:43989]
    Gene: Rfr-domain protein
    Database cross-references and differences (RAF-indexed):
    • PDB 2F3L
    Domains in SCOPe 2.05: d2f3la1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f3lA (A:)
    mhhhhhhssglvprgsgmketaakferqhmdspdlgtddddkamamvtgssasyedvkli
    gedfsgksltyaqftnadltdsnfseadlrgavfngsaligadlhgadltnglayltsfk
    gadltnavlteaimmrtkfddakitgadfslavldvyevdklcdradgvnpktgvstres
    lrcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3lA (A:)
    asyedvkligedfsgksltyaqftnadltdsnfseadlrgavfngsaligadlhgadltn
    glayltsfkgadltnavlteaimmrtkfddakitgadfslavldvyevdklcdradgvnp
    ktgvstreslrc