PDB entry 2f3i

View 2f3i on RCSB PDB site
Description: Solution Structure of a Subunit of RNA Polymerase II
Class: Transferase
Keywords: RNA Polymerase II, Transferase
Deposited on 2005-11-21, released 2006-05-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2f3ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f3iA (A:)
    magilfedifdvkdidpegkkfdrvsrlhcesesfkmdlildvniqiypvdlgdkfrlvi
    astlyedgtlddgeynptddrpsradqfeyvmygkvyriegdetsteaatrlsayvsygg
    llmrlqgdannlhgfevdsrvyllmkklaf