PDB entry 2f3c

View 2f3c on RCSB PDB site
Description: Crystal structure of infestin 1, a Kazal-type serineprotease inhibitor, in complex with trypsin
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease - inhibitor complex, Kazal-type domain
Deposited on 2005-11-20, released 2006-12-05
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-05, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.17
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: cationic trypsin
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f3ce1
  • Chain 'I':
    Compound: thrombin inhibitor infestin
    Species: Triatoma infestans
    Database cross-references and differences (RAF-indexed):
    • GB AAK57342
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2f3cE (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3cE (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnvasislptscasagtqclisgwg
    ntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpvv
    csgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'I':
    No sequence available.