PDB entry 2f3c

View 2f3c on RCSB PDB site
Description: Crystal structure of infestin 1, a Kazal-type serineprotease inhibitor, in complex with trypsin
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease - inhibitor complex, Kazal-type domain, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2005-11-20, released 2006-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f3ce_
  • Chain 'I':
    Compound: thrombin inhibitor infestin
    Species: Triatoma infestans [TaxId:30076]
    Database cross-references and differences (RAF-indexed):
    • GB AAK57342
    Domains in SCOPe 2.07: d2f3ci1
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2f3cE (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3cE (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnvasislptscasagtqclisgwg
    ntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpvv
    csgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2f3cI (I:)
    leendcacprvlhrvcgsdgntysnpctldcakhegkpdlvqvhegpcdpndhdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3cI (I:)
    dcacprvlhrvcgsdgntysnpctldcakhegkpdlvqvhegpcdp