PDB entry 2f2t

View 2f2t on RCSB PDB site
Description: Crystal structure of Nucleoside 2-deoxyribosyltransferase from Trypanosoma brucei at 1.7 A resolution with 5-Aminoisoquinoline bound
Class: transferase
Keywords: SGPP, Structural GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE NDRT, Nucleoside 2-deoxyribosyltransferase, Trypanosoma brucei, Structural Genomics of Pathogenic Protozoa Consortium, TRANSFERASE
Deposited on 2005-11-17, released 2005-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.178
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoside 2-deoxyribosyltransferase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb05.30H13.400
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57VC7 (8-End)
      • expression tag (2-7)
      • modified residue (8)
      • modified residue (23)
      • modified residue (41)
      • see remark 999 (52)
      • modified residue (63)
      • see remark 999 (92)
      • modified residue (99)
      • modified residue (110)
      • see remark 999 (117)
      • modified residue (135)
    Domains in SCOPe 2.08: d2f2ta2, d2f2ta3
  • Chain 'B':
    Compound: nucleoside 2-deoxyribosyltransferase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb05.30H13.400
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57VC7 (8-End)
      • expression tag (2-7)
      • modified residue (8)
      • modified residue (23)
      • modified residue (41)
      • see remark 999 (52)
      • modified residue (63)
      • see remark 999 (92)
      • modified residue (99)
      • modified residue (110)
      • see remark 999 (117)
      • modified residue (135)
    Domains in SCOPe 2.08: d2f2tb2, d2f2tb3
  • Heterogens: SO4, 5IQ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f2tA (A:)
    mahhhhhhmrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqk
    niqmikdcdaviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvd
    kdnlrvegfglpfnlmlydgvevfdsfesafkyflanfpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f2tA (A:)
    hhhhhhmrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqkni
    qmikdcdaviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvdkd
    nlrvegfglpfnlmlydgvevfdsfesafkyflanfps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f2tB (B:)
    mahhhhhhmrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqk
    niqmikdcdaviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvd
    kdnlrvegfglpfnlmlydgvevfdsfesafkyflanfpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f2tB (B:)
    hhhhhhmrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqkni
    qmikdcdaviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvdkd
    nlrvegfglpfnlmlydgvevfdsfesafkyflanfps