PDB entry 2f2l

View 2f2l on RCSB PDB site
Description: Crystal structure of tracheal cytotoxin (TCT) bound to the ectodomain complex of peptidoglycan recognition proteins LCa (PGRP-LCa) and LCx (PGRP-LCx)
Class: membrane protein, immune system, toxin
Keywords: Protein-peptidoglycan complex, MEMBRANE PROTEIN, IMMUNE SYSTEM, TOXIN
Deposited on 2005-11-17, released 2006-04-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidoglycan-recognition protein-LC isoform LCa
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GNK5 (1-166)
      • cloning artifact (0)
      • modified residue (60)
    Domains in SCOPe 2.08: d2f2la2, d2f2la3
  • Chain 'X':
    Compound: Peptidoglycan recognition protein-LC isoform LCx
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • GB AAM18530 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d2f2lx1, d2f2lx2
  • Heterogens: NAG, HSQ, SO4, MLD, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f2lA (A:)
    dfverqqwlaqppqkeipdlelpvglvialptnsencstqaicvlrvrllqtydiessqk
    cdiaynfliggdgnvyvgrgwnkmgahmnninydsqslsfayigsfktiqpsakqlsvtr
    lllergvklgkiapsyrftassklmpsvtdfkadalyasfanwthws
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2f2lX (X:)
    mvilkvaewggrpakrmldaqqlpinrvvishtaaegcesrevcsarvnvvqsfhmdswg
    wdhigynflvggdgrvyegrgwdyvgahtkgynrgsigisfigtfttrkpnerqleacql
    llqegvrlkklttnyrlyghrqlsatespgeelykiikkwphwshei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f2lX (X:)
    mvilkvaewggrpakrmldaqqlpinrvvishtaaegcesrevcsarvnvvqsfhmdswg
    wdhigynflvggdgrvyegrgwdyvgahtkgynrgsigisfigtfttrkpnerqleacql
    llqegvrlkklttnyrlyghrqlsatespgeelykiikkwphwshe