PDB entry 2f2k

View 2f2k on RCSB PDB site
Description: Aldose reductase tertiary complex with NADPH and DEG
Class: oxidoreductase
Keywords: inhibitor, glutathione, tertiary complex, dicarboxyethyl glutathione
Deposited on 2005-11-17, released 2006-05-16
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.196
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldose reductase
    Species: HOMO SAPIENS
    Gene: AKR1B1, ALDR1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f2ka1
  • Heterogens: NDP, TGG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f2kA (A:)
    masrlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiq
    eklreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgk
    effpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykp
    avnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaak
    hnkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvca
    llsctshkdypfheef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f2kA (A:)
    asrlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqe
    klreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgke
    ffpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpa
    vnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaakh
    nkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvcal
    lsctshkdypfheef