PDB entry 2f2g

View 2f2g on RCSB PDB site
Description: X-Ray Structure of Gene Product From Arabidopsis Thaliana AT3G16990
Class: plant protein
Keywords: TENA_THI-4 DOMAIN, TENA/THI-4/PQQC FAMILY, AT3G16990, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, CESG, CENTER FOREUKARYOTIC STRUCTURAL GENOMICS, Center for Eukaryotic Structural Genomics, PLANT PROTEIN
Deposited on 2005-11-16, released 2005-12-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: seed maturation protein pm36 homolog
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g16990
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ASY9
      • modified residue (74)
      • modified residue (122)
      • modified residue (132)
      • modified residue (215)
    Domains in SCOPe 2.08: d2f2ga_
  • Chain 'B':
    Compound: seed maturation protein pm36 homolog
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g16990
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ASY9
      • modified residue (74)
      • modified residue (122)
      • modified residue (132)
      • modified residue (215)
    Domains in SCOPe 2.08: d2f2gb_
  • Heterogens: SO4, HMH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f2gA (A:)
    mekrgvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvas
    vlirackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfle
    dlmssevkypvimtafwaieavyqesfahcledgnktpveltgachrwgndgfkqycssv
    kniaerclenasgevlgeaedvlvrvlelevafwemsrggq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f2gA (A:)
    gvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvasvlir
    ackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfledlms
    sevkypvimtafwaieavyqesfahcledgnktpveltgachrwgndgfkqycssvknia
    erclenasgevlgeaedvlvrvlelevafwemsrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f2gB (B:)
    mekrgvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvas
    vlirackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfle
    dlmssevkypvimtafwaieavyqesfahcledgnktpveltgachrwgndgfkqycssv
    kniaerclenasgevlgeaedvlvrvlelevafwemsrggq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f2gB (B:)
    rgvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvasvli
    rackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfledlm
    ssevkypvimtafwaieavyqesfahcktpveltgachrwgndgfkqycssvkniaercl
    enasgevlgeaedvlvrvlelevafwemsrg