PDB entry 2f2f

View 2f2f on RCSB PDB site
Description: Crystal structure of cytolethal distending toxin (CDT) from Actinobacillus actinomycetemcomitans
Class: toxin
Keywords: Cytolethal distending toxin, CDT, Actinobacillus actinomycetemcomitans, crystal structure, oligomerization, stability and toxic activity
Deposited on 2005-11-16, released 2006-03-28
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.221
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytolethal distending toxin A
    Species: Actinobacillus actinomycetemcomitans
    Gene: cdtA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f2fa1
  • Chain 'B':
    Compound: Cytolethal distending toxin B
    Species: Actinobacillus actinomycetemcomitans
    Gene: cdtB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7DK12 (Start-282)
      • see remark 999 (280)
    Domains in SCOP 1.73: d2f2fb1
  • Chain 'C':
    Compound: cytolethal distending toxin C
    Species: Actinobacillus actinomycetemcomitans
    Gene: cdtC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7DK11
      • see remark 999 (171)
    Domains in SCOP 1.73: d2f2fc1
  • Chain 'D':
    Compound: Cytolethal distending toxin A
    Species: Actinobacillus actinomycetemcomitans
    Gene: cdtA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2f2fd1
  • Chain 'E':
    Compound: Cytolethal distending toxin B
    Species: Actinobacillus actinomycetemcomitans
    Gene: cdtB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7DK12 (Start-282)
      • see remark 999 (280)
    Domains in SCOP 1.73: d2f2fe1
  • Chain 'F':
    Compound: cytolethal distending toxin C
    Species: Actinobacillus actinomycetemcomitans
    Gene: cdtC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7DK11
      • see remark 999 (171)
    Domains in SCOP 1.73: d2f2ff1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f2fA (A:)
    mkkflpglllmglvacssnqrmsdysqpesqsdlapkssttqfqpqpllskassmplnll
    ssskngqvspsepsnfmtlmgqngalltvwalakrnwlwaypniysqdfgnirnwkiepg
    khreyfrfvnqslgtcieaygnglihdtcsldklaqefellptdsgavviksvsqgrcvt
    ynpvsptyystvtlstcdgateplrdqtwylappvleatavn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f2fA (A:)
    psepsnfmtlmgqngalltvwalakrnwlwaypniysqdfgnirnwkiepgkhreyfrfv
    nqslgtcieaygnglihdtcsldklaqefellptdsgavviksvsqgrcvtynpvsptyy
    stvtlstcdgateplrdqtwylappvleatavn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f2fB (B:)
    mqwvkqlnvvfctmlfsfssyanlsdfkvatwnlqgssavneskwninvrqllsgeqgad
    ilmvqeagslpssavrtsrviqhggtpieeytwnlgtrsrpnmvyiyysrldvganrvnl
    aivsrrqadeafivhsdssvlqsrpavgirigtdvfftvhalatggsdavslirnifttf
    tsspssperrgyswmvvgdfnrapvnleaalrqepavsentiiiaptepthrsgnildya
    ilhdahlprreqarerigaslmlnqlrsqitsdhfpvsfvhdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f2fB (B:)
    nlsdfkvatwnlqgssavneskwninvrqllsgeqgadilmvqeagslpssavrtsrviq
    hggtpieeytwnlgtrsrpnmvyiyysrldvganrvnlaivsrrqadeafivhsdssvlq
    srpavgirigtdvfftvhalatggsdavslirnifttftsspssperrgyswmvvgdfnr
    apvnleaalrqepavsentiiiaptepthrsgnildyailhdahlprreqarerigaslm
    lnqlrsqitsdhfpvsfvhdr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f2fC (C:)
    mkkyllsfllsmiltltshaesnpdpttypdvelsppprislrslltaqpikndhydshn
    ylsthwelidykgkeyeklrdggtlvqfkvvgaakcfafpgegttdckdidhtvfnlipt
    ntgaflikdallgfcmtshdfddlrlepcgisvsgrtfslayqwgilppfgpskilrppv
    grnqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f2fC (C:)
    dpttypdvelsppprislrslltaqpikndhydshnylsthwelidykgkeyeklrdggt
    lvqfkvvgaakcfafpgegttdckdidhtvfnliptntgaflikdallgfcmtshdfddl
    rlepcgisvsgrtfslayqwgilppfgpskilrp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2f2fD (D:)
    mkkflpglllmglvacssnqrmsdysqpesqsdlapkssttqfqpqpllskassmplnll
    ssskngqvspsepsnfmtlmgqngalltvwalakrnwlwaypniysqdfgnirnwkiepg
    khreyfrfvnqslgtcieaygnglihdtcsldklaqefellptdsgavviksvsqgrcvt
    ynpvsptyystvtlstcdgateplrdqtwylappvleatavn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f2fD (D:)
    psepsnfmtlmgqngalltvwalakrnwlwaypniysqdfgnirnwkiepgkhreyfrfv
    nqslgtcieaygnglihdtcsldklaqefellptdsgavviksvsqgrcvtynpvsptyy
    stvtlstcdgateplrdqtwylappvleatavn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2f2fE (E:)
    mqwvkqlnvvfctmlfsfssyanlsdfkvatwnlqgssavneskwninvrqllsgeqgad
    ilmvqeagslpssavrtsrviqhggtpieeytwnlgtrsrpnmvyiyysrldvganrvnl
    aivsrrqadeafivhsdssvlqsrpavgirigtdvfftvhalatggsdavslirnifttf
    tsspssperrgyswmvvgdfnrapvnleaalrqepavsentiiiaptepthrsgnildya
    ilhdahlprreqarerigaslmlnqlrsqitsdhfpvsfvhdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f2fE (E:)
    nlsdfkvatwnlqgssavneskwninvrqllsgeqgadilmvqeagslpssavrtsrviq
    hggtpieeytwnlgtrsrpnmvyiyysrldvganrvnlaivsrrqadeafivhsdssvlq
    srpavgirigtdvfftvhalatggsdavslirnifttftsspssperrgyswmvvgdfnr
    apvnleaalrqepavsentiiiaptepthrsgnildyailhdahlprreqarerigaslm
    lnqlrsqitsdhfpvsfvhdr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2f2fF (F:)
    mkkyllsfllsmiltltshaesnpdpttypdvelsppprislrslltaqpikndhydshn
    ylsthwelidykgkeyeklrdggtlvqfkvvgaakcfafpgegttdckdidhtvfnlipt
    ntgaflikdallgfcmtshdfddlrlepcgisvsgrtfslayqwgilppfgpskilrppv
    grnqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f2fF (F:)
    dpttypdvelsppprislrslltaqpikndhydshnylsthwelidykgkeyeklrdggt
    lvqfkvvgaakcfafpgegttdckdidhtvfnliptntgaflikdallgfcmtshdfddl
    rlepcgisvsgrtfslayqwgilppfgpskilrp