PDB entry 2f2c

View 2f2c on RCSB PDB site
Description: X-ray structure of human CDK6-Vcyclinwith the inhibitor aminopurvalanol
Class: cell cycle/transferase
Keywords: Small molecule inhibitor bound between N-terminal and C-terminal domain of kinase, CELL CYCLE-TRANSFERASE COMPLEX
Deposited on 2005-11-16, released 2006-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.241
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin homolog
    Species: Herpesvirus saimiri (strain 11) [TaxId:10383]
    Gene: 72, ECLF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f2ca1, d2f2ca2
  • Chain 'B':
    Compound: cell division protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f2cb_
  • Heterogens: SO4, AP9, DMS

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f2cA (A:)
    madspnrlnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmh
    llcesfeldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvsklt
    ylscdcftnlelinqekdilealkwdteavlatdfliplcnalkipedlwpqlyeaastt
    ickaliqpniallspglicaggllttietdntncrpwtcyledlssilnfstntvrtvkd
    qvseafslydleil
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f2cA (A:)
    lnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfe
    ldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylsftnl
    elinqekdilealkwdteavlatdfliplcnalkipedlwpqlyeaasttickaliqpni
    allspglicaggllttietdntncrpwtcyledlssilnfstntvrtvkdqvseafslyd
    leil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f2cB (B:)
    mekdglcradqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstir
    evavlrhletfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvpte
    tikdmmfqllrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvv
    vtlwyrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpge
    edwprdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyf
    qdlercke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f2cB (B:)
    adqqyecaeiggkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhletfeh
    pnvvrlfdvctvstdretkltlvfehvdqdlttyldkvpepgvptetikdmmfqllrgld
    flhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrapevllqs
    syatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwpqafaqpiekf
    vtdidelgkdlllkcltfnpakrisaysalshpyfqdler