PDB entry 2f23

View 2f23 on RCSB PDB site
Description: Crystal structure of GreA factor homolog 1 (Gfh1) protein of Thermus thermophilus
Class: transcription
Keywords: crystal structure anti-grea gfh1 Thermus thermophilus, TRANSCRIPTION
Deposited on 2005-11-15, released 2006-05-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.206
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-cleavage anti-GreA transcription factor Gfh1
    Species: Thermus thermophilus [TaxId:262724]
    Gene: gfh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f23a1, d2f23a2
  • Chain 'B':
    Compound: anti-cleavage anti-GreA transcription factor Gfh1
    Species: Thermus thermophilus [TaxId:262724]
    Gene: gfh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f23b1, d2f23b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f23A (A:)
    marevkltkagyerlmqqlerererlqeatkilqelmessddyddsgleaakqekariea
    ridsledilsravileegsgeviglgsvveledplsgerlsvqvvspaeanvldtpmkis
    daspmgkallghrvgdvlsldtpkgkrefrvvaihg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f23A (A:)
    revkltkagyerlmqqlerererlqeatkilqelmessddyddsgleaakqekarieari
    dsledilsravileegsgeviglgsvveledplsgerlsvqvvspaeanvldtpmkisda
    spmgkallghrvgdvlsldtpkgkrefrvvaihg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f23B (B:)
    marevkltkagyerlmqqlerererlqeatkilqelmessddyddsgleaakqekariea
    ridsledilsravileegsgeviglgsvveledplsgerlsvqvvspaeanvldtpmkis
    daspmgkallghrvgdvlsldtpkgkrefrvvaihg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f23B (B:)
    revkltkagyerlmqqlerererlqeatkilqelmessddyddsgleaakqekarieari
    dsledilsravileegsgeviglgsvveledplsgerlsvqvvspaeanvldtpmkisda
    spmgkallghrvgdvlsldtpkgkrefrvvaihg