PDB entry 2f1l

View 2f1l on RCSB PDB site
Description: crystal structure of a putative 16s ribosomal RNA processing protein rimm (pa3744) from pseudomonas aeruginosa at 2.46 a resolution
Class: unknown function
Keywords: 16s rRNA processing protein, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, unknown function
Deposited on 2005-11-14, released 2006-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.177
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16S rRNA processing protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: 9949912
    Database cross-references and differences (RAF-indexed):
    • GB AAG07131 (Start-186)
      • modified residue (145)
      • modified residue (178)
    Domains in SCOPe 2.07: d2f1la1, d2f1la2
  • Heterogens: UNL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f1lA (A:)
    mgsdkihhhhhhmptpaddlvvigkivsvygirgevkvysftdpldnlldyrrwtlrrdg
    eirqaelvrgrlhgkvlaaklkglddreeartftgyeiciprselpsleegeyywhqleg
    lkvidqgrqllgvidhlletgandvmvvkpcagslddrerllpytgqcvlsidlaagemr
    vdwdadf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1lA (A:)
    dlvvigkivsvygirgevkvysftdpldnlldyrrwtlrrdgeirqaelvrgrlhgkvla
    aklkglddreeartftgyeiciprselpsyywhqleglkvidqgrqllgvidhlletgan
    dvmvvkpcagslddrerllpytgqcvlsidlaagemrvdwdadf