PDB entry 2f1k

View 2f1k on RCSB PDB site
Description: Crystal structure of Synechocystis arogenate dehydrogenase
Class: oxidoreductase
Keywords: arogenate/prephenate dehydrogenase, tyrosine synthesis, X-ray crystallography structure, OXIDOREDUCTASE
Deposited on 2005-11-14, released 2006-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prephenate dehydrogenase
    Species: Synechocystis sp. [TaxId:1148]
    Gene: D90910.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P73906 (0-278)
      • modified residue (113)
      • modified residue (149)
    Domains in SCOPe 2.07: d2f1ka1, d2f1ka2
  • Chain 'B':
    Compound: prephenate dehydrogenase
    Species: Synechocystis sp. [TaxId:1148]
    Gene: D90910.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P73906 (0-278)
      • modified residue (113)
      • modified residue (149)
    Domains in SCOPe 2.07: d2f1kb1, d2f1kb2
  • Chain 'C':
    Compound: prephenate dehydrogenase
    Species: Synechocystis sp. [TaxId:1148]
    Gene: D90910.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P73906 (0-End)
      • modified residue (113)
      • modified residue (149)
    Domains in SCOPe 2.07: d2f1kc1, d2f1kc2
  • Chain 'D':
    Compound: prephenate dehydrogenase
    Species: Synechocystis sp. [TaxId:1148]
    Gene: D90910.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P73906 (0-278)
      • modified residue (113)
      • modified residue (149)
    Domains in SCOPe 2.07: d2f1kd1, d2f1kd2
  • Heterogens: NAP, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f1kA (A:)
    mkigvvglgligaslagdlrrrghyligvsrqqstcekaverqlvdeagqdlsllqtaki
    iflctpiqlilptlekliphlsptaivtdvasvktaiaepasqlwsgfigghpmagtaaq
    gidgaeenlfvnapyvltpteytdpeqlaclrsvleplgvkiylctpadhdqavawishl
    pvmvsaaliqacagekdgdilklaqnlassgfrdtsrvgggnpelgtmmatynqrallks
    lqdyrqhldqlitlisnqqwpelhrllqqtngdrdkyve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f1kB (B:)
    mkigvvglgligaslagdlrrrghyligvsrqqstcekaverqlvdeagqdlsllqtaki
    iflctpiqlilptlekliphlsptaivtdvasvktaiaepasqlwsgfigghpmagtaaq
    gidgaeenlfvnapyvltpteytdpeqlaclrsvleplgvkiylctpadhdqavawishl
    pvmvsaaliqacagekdgdilklaqnlassgfrdtsrvgggnpelgtmmatynqrallks
    lqdyrqhldqlitlisnqqwpelhrllqqtngdrdkyve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f1kC (C:)
    mkigvvglgligaslagdlrrrghyligvsrqqstcekaverqlvdeagqdlsllqtaki
    iflctpiqlilptlekliphlsptaivtdvasvktaiaepasqlwsgfigghpmagtaaq
    gidgaeenlfvnapyvltpteytdpeqlaclrsvleplgvkiylctpadhdqavawishl
    pvmvsaaliqacagekdgdilklaqnlassgfrdtsrvgggnpelgtmmatynqrallks
    lqdyrqhldqlitlisnqqwpelhrllqqtngdrdkyve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1kC (C:)
    mkigvvglgligaslagdlrrrghyligvsrqqstcekaverqlvdeagqdlsllqtaki
    iflctpiqlilptlekliphlsptaivtdvasvktaiaepasqlwsgfigghpmagtaaq
    gidgaeenlfvnapyvltpteytdpeqlaclrsvleplgvkiylctpadhdqavawishl
    pvmvsaaliqacagekdgdilklaqnlassgfrdtsrvgggnpelgtmmatynqrallks
    lqdyrqhldqlitlisnqqwpelhrllqqtngdrdkyv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f1kD (D:)
    mkigvvglgligaslagdlrrrghyligvsrqqstcekaverqlvdeagqdlsllqtaki
    iflctpiqlilptlekliphlsptaivtdvasvktaiaepasqlwsgfigghpmagtaaq
    gidgaeenlfvnapyvltpteytdpeqlaclrsvleplgvkiylctpadhdqavawishl
    pvmvsaaliqacagekdgdilklaqnlassgfrdtsrvgggnpelgtmmatynqrallks
    lqdyrqhldqlitlisnqqwpelhrllqqtngdrdkyve