PDB entry 2f1e

View 2f1e on RCSB PDB site
Description: Solution structure of ApaG protein
Class: structural genomics, unknown function
Keywords: ApaG protein, NMR, Xanthomonas axonopodis pv.citri, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2005-11-14, released 2006-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein apaG
    Species: Xanthomonas axonopodis pv. citri [TaxId:92829]
    Gene: apaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f1ea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f1eA (A:)
    mqddpryrvevevsprflahqstpdegryafaysiriqnagavparlvarhwqitdgngr
    teqvdgegvvgeqpwlrpgeafhytsgvlleteqgqmqghydmvaddgtefiapiaafvl
    svprtlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1eA (A:)
    ryrvevevsprflahqstpdegryafaysiriqnagavparlvarhwqitdgngrteqvd
    gegvvgeqpwlrpgeafhytsgvlleteqgqmqghydmvaddgtefiapiaafvls