PDB entry 2f1d

View 2f1d on RCSB PDB site
Description: X-Ray Structure of imidazoleglycerol-phosphate dehydratase
Class: lyase
Keywords: IGPD, herbicide, manganese, histidine biosynthesis, LYASE
Deposited on 2005-11-14, released 2006-01-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.243
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Imidazoleglycerol-phosphate dehydratase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f1da1, d2f1da2
  • Chain 'B':
    Compound: Imidazoleglycerol-phosphate dehydratase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f1db1, d2f1db2
  • Chain 'C':
    Compound: Imidazoleglycerol-phosphate dehydratase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f1dc1, d2f1dc2
  • Chain 'D':
    Compound: Imidazoleglycerol-phosphate dehydratase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f1dd1, d2f1dd2
  • Chain 'E':
    Compound: Imidazoleglycerol-phosphate dehydratase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f1de1, d2f1de2
  • Chain 'F':
    Compound: Imidazoleglycerol-phosphate dehydratase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f1df1, d2f1df2
  • Chain 'G':
    Compound: Imidazoleglycerol-phosphate dehydratase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f1dg1, d2f1dg2
  • Chain 'H':
    Compound: Imidazoleglycerol-phosphate dehydratase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f1dh1, d2f1dh2
  • Chain 'I':
    Compound: Imidazoleglycerol-phosphate dehydratase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f1di1, d2f1di2
  • Chain 'J':
    Compound: Imidazoleglycerol-phosphate dehydratase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f1dj1, d2f1dj2
  • Chain 'K':
    Compound: Imidazoleglycerol-phosphate dehydratase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f1dk1, d2f1dk2
  • Chain 'L':
    Compound: Imidazoleglycerol-phosphate dehydratase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f1dl1, d2f1dl2
  • Chain 'M':
    Compound: Imidazoleglycerol-phosphate dehydratase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f1dm1, d2f1dm2
  • Chain 'N':
    Compound: Imidazoleglycerol-phosphate dehydratase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f1dn1, d2f1dn2
  • Chain 'O':
    Compound: Imidazoleglycerol-phosphate dehydratase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f1do1, d2f1do2
  • Chain 'P':
    Compound: Imidazoleglycerol-phosphate dehydratase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f1dp1, d2f1dp2
  • Heterogens: MN, SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f1dA (A:)
    asssssmalgrigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdv
    hvratgdvhiddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsg
    rpylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafa
    ralrqatetdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1dA (A:)
    grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
    iddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafaralrqatet
    dpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f1dB (B:)
    asssssmalgrigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdv
    hvratgdvhiddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsg
    rpylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafa
    ralrqatetdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1dB (B:)
    grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
    iddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafaralrqatet
    dpr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f1dC (C:)
    asssssmalgrigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdv
    hvratgdvhiddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsg
    rpylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafa
    ralrqatetdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1dC (C:)
    grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
    iddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafaralrqatet
    dpr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2f1dD (D:)
    asssssmalgrigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdv
    hvratgdvhiddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsg
    rpylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafa
    ralrqatetdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1dD (D:)
    grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
    iddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafaralrqatet
    dpr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2f1dE (E:)
    asssssmalgrigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdv
    hvratgdvhiddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsg
    rpylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafa
    ralrqatetdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1dE (E:)
    grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
    iddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafaralrqatet
    dpr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2f1dF (F:)
    asssssmalgrigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdv
    hvratgdvhiddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsg
    rpylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafa
    ralrqatetdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1dF (F:)
    grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
    iddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafaralrqatet
    dpr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2f1dG (G:)
    asssssmalgrigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdv
    hvratgdvhiddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsg
    rpylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafa
    ralrqatetdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1dG (G:)
    grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
    iddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafaralrqatet
    dpr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2f1dH (H:)
    asssssmalgrigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdv
    hvratgdvhiddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsg
    rpylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafa
    ralrqatetdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1dH (H:)
    grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
    iddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafaralrqatet
    dpr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2f1dI (I:)
    asssssmalgrigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdv
    hvratgdvhiddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsg
    rpylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafa
    ralrqatetdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1dI (I:)
    grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
    iddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafaralrqatet
    dpr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2f1dJ (J:)
    asssssmalgrigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdv
    hvratgdvhiddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsg
    rpylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafa
    ralrqatetdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1dJ (J:)
    grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
    iddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafaralrqatet
    dpr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2f1dK (K:)
    asssssmalgrigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdv
    hvratgdvhiddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsg
    rpylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafa
    ralrqatetdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1dK (K:)
    grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
    iddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafaralrqatet
    dpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2f1dL (L:)
    asssssmalgrigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdv
    hvratgdvhiddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsg
    rpylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafa
    ralrqatetdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1dL (L:)
    grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
    iddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafaralrqatet
    dpr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2f1dM (M:)
    asssssmalgrigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdv
    hvratgdvhiddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsg
    rpylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafa
    ralrqatetdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1dM (M:)
    grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
    iddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafaralrqatet
    dpr
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2f1dN (N:)
    asssssmalgrigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdv
    hvratgdvhiddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsg
    rpylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafa
    ralrqatetdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1dN (N:)
    grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
    iddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafaralrqatet
    dpr
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2f1dO (O:)
    asssssmalgrigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdv
    hvratgdvhiddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsg
    rpylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafa
    ralrqatetdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1dO (O:)
    grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
    iddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafaralrqatet
    dpr
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2f1dP (P:)
    asssssmalgrigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdv
    hvratgdvhiddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsg
    rpylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafa
    ralrqatetdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1dP (P:)
    grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
    iddhhtnedialaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagenshhiieatfkafaralrqatet
    dpr