PDB entry 2f19

View 2f19 on RCSB PDB site
Description: three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1992-05-27, released 1992-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.182
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2b-kappa r19.9 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2F19 (0-220)
    Domains in SCOPe 2.06: d2f19h1, d2f19h2
  • Chain 'L':
    Compound: igg2b-kappa r19.9 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2f19l1, d2f19l2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f19H (H:)
    qvqlqqsgaelvragssvkmsckasgytftsygvnwvkqrpgqglewigyinpgkgylsy
    nekfkgkttltvdrssstaymqlrsltsedaavyfcarsfyggsdlavyyfdswgqgttl
    tvssakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpal
    lqsalytmsssvtvpsstwpsqtvtcsvahpassttvdkkl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f19L (L:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltisnlehediatyfcqqgstlprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec