PDB entry 2f18

View 2f18 on RCSB PDB site
Description: GOLGI ALPHA-MANNOSIDASE II complex with (2R,3R,4S)-2-({[(1R)-2-hydroxy-1-phenylethyl]amino}methyl)pyrrolidine-3,4-diol
Class: Hydrolase
Keywords: glycosyl hydrolase family 38
Deposited on 2005-11-14, released 2006-12-05
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.168
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-mannosidase II
    Species: Drosophila melanogaster
    Gene: alpha-Man-II, GmII
    Database cross-references and differences (RAF-indexed):
    • GB CAA54732
    Domains in SCOP 1.73: d2f18a1, d2f18a2, d2f18a3
  • Heterogens: NAG, PO4, ZN, GB1, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f18A (A:)
    rsshhhhhhgefddpirpplkvarsprpgqcqdvvqdvpnvdvqmlelydrmsfkdidgg
    vwkqgwnikydplkynahhklkvfvvphshndpgwiqtfeeyyqhdtkhilsnalrhlhd
    npemkfiwaeisyfarfyhdlgenkklqmksivkngqlefvtggwvmpdeanshwrnvll
    qltegqtwlkqfmnvtptaswaidpfghsptmpyilqksgfknmliqrthysvkkelaqq
    rqleflwrqiwdnkgdtalfthmmpfysydiphtcgpdpkvccqfdfkrmgsfglscpwk
    vpprtisdqnvaarsdllvdqwkkkaelyrtnvlliplgddfrfkqntewdvqrvnyerl
    fehinsqahfnvqaqfgtlqeyfdavhqaeragqaefptlsgdfftyadrsdnywsgyyt
    srpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhhdgitgtakt
    hvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfsyftlddsrwpgsgvedsr
    ttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtdlannpveaqvspvwswhh
    dtltktihpqgsttkyriifkarvppmglatyvltisdskpehtsyasnlllrknptslp
    lgqypedvkfgdpreislrvgngptlafseqgllksiqltqdsphvpvhfkflkygvrsh
    gdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglpsvvhqtimrggapeirnlv
    digsldnteivmrlethidsgdifytdlnglqfikrrrldklplqanyypipsgmfieda
    ntrltlltgqplggsslasgeleimqdrrlasdderglgqgvldnkpvlhiyrlvlekvn
    ncvrpsklhpagyltsaahkasqslldpldkfifaenewigaqgqfggdhpsaredldvs
    vmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchllpnvarcerttltflqnl
    ehldgmvapevcpmetaayvsshss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f18A (A:)
    cqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphsh
    ndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqmk
    sivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghsp
    tmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysyd
    iphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaelyr
    tnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqae
    ragqaefptlsgdfftyadrsdnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdg
    marieerleqarrelslfqhhdgitgtakthvvvdyeqrmqealkacqmvmqqsvyrllt
    kpsiyspdfsfsyftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvd
    fyvsspfvsvtdlannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmgla
    tyvltisdskpehtsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafse
    qgllksiqltqdsphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkg
    klessvsvglpsvvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlng
    lqfikrrrldklplqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrl
    asdderglgqgvldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpld
    kfifaenewigaqgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtp
    eehtqkldvchllpnvarcerttltflqnlehldgmvapevcpmetaayvsshs