PDB entry 2f15

View 2f15 on RCSB PDB site
Description: Glycogen-Binding Domain Of The Amp-Activated Protein Kinase beta2 Subunit
Class: sugar binding protein
Keywords: beta sandwich, fatty acid biosynthesis, lipid synthesis, phosphorylation, structural genomics consortium, sgc
Deposited on 2005-11-14, released 2005-12-27
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.239
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-AMP-activated protein kinase, beta-2 subunit
    Species: HOMO SAPIENS
    Gene: PRKAB2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2f15a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f15A (A:)
    gsvkptqqarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykf
    fvdgqwvhdpsepvvtsqlgtinnlihvkksdfevf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f15A (A:)
    qarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgqwv
    hdpsepvvtsqlgtinnlihvkksdfevf