PDB entry 2f11

View 2f11 on RCSB PDB site
Description: Crystal Structure of the Human Sialidase Neu2 in Complex with isobutyl ether mimetic Inhibitor
Class: hydrolase
Keywords: sialidase, neuraminidase, influenza virus, drug design
Deposited on 2005-11-14, released 2006-11-21
The last revision prior to the SCOP 1.75 freeze date was dated 2006-11-21, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.208
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sialidase 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2f11a1
  • Heterogens: PO4, IEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f11A (A:)
    gsmaslpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgd
    ydapthqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtr
    anvtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpa
    yayrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnars
    hlrarvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgspaqwllythp
    thswqradlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeand
    yeeivflmftlkqafpaeylpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f11A (A:)
    slpvlqkesvfqsgahayripallylpgqqsllafaeqraelivlrrgdydapthqvqwq
    aqevvaqarldghrsmnpcplydaqtgtlflffiaipanvtrlcqvtstdhgrtwssprd
    ltdaaigpayrewstfavgpghclqlndrarslvvpayayrkliqrpipsafcflshdhg
    rtwarghfvaqdtlecqvaevetgeqrvvtlnarshlrarvqaqstndgldfqesqlvkk
    lvepppqgcqgsvisfpspraqwllythpthswqradlgaylnprppapeawsepvllak
    gscaysdlqsmgtgpdgsplfgclyeandyeeivflmftlkqafpae