PDB entry 2f0y

View 2f0y on RCSB PDB site
Description: Crystal Structure Of Human Protein Farnesyltransferase Complexed With Farnesyl Diphosphate and hydantoin derivative
Class: transferase
Keywords: farnesyltransferase
Deposited on 2005-11-14, released 2006-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.212
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f0ya_
  • Chain 'B':
    Compound: Protein farnesyltransferase beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f0yb_
  • Heterogens: ZN, FPP, 3MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f0yA (A:)
    maategvgeaaqggepgqpaqpppqphppppqqqhkeemaaeageavaspmddgfvslds
    psyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrvlvewlr
    dpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnnsvwnqr
    yfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhstendsptnvqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f0yA (A:)
    fvsldspsyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrv
    lvewlrdpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnn
    svwnqryfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f0yB (B:)
    maspssftyycppssspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfs
    sykfnhlvprlvlqrekhfhylkrglrqltdayecldasrpwlcywilhslelldepipq
    ivatdvcqflelcqspeggfgggpgqyphlaptyaavnalciigteeaydiinrekllqy
    lyslkqpdgsflmhvggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggig
    gvpgmeahggytfcglaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcy
    sfwqagllpllhralhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdf
    yhtcyclsglsiaqhfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpv
    pgfeelkdetsaepatd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f0yB (B:)
    eplyslrpeharerlqddsvetvtsieqakveekiqevfssykrlvlqrekhfhylkrgl
    rqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspeggfgggpgq
    yphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmhvggevdvrsayc
    aasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvilkrer
    slnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpalsms
    hwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgamlhdvv
    lgvpenalqpthpvynigpdkviqattyflqkpvp